PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009605048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Nin-like
Protein Properties Length: 714aa    MW: 82210.4 Da    PI: 6.9487
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009605048.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK56.36.3e-18539587351
          RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiks 51 
                     ++++ +dl+++F++++ dAA +L+v+ ++LKr CR+yGI+RWP+ k k+
  XP_009605048.1 539 DSVNYDDLKQHFNKNLSDAAESLQVSRSTLKRLCRKYGIRRWPSSKRKK 587
                     678899*************************************988665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151914.152525610IPR003035RWP-RK domain
PfamPF020426.7E-18541587IPR003035RWP-RK domain
Gene3DG3DSA:1.10.10.602.0E-5550577IPR009057Homeodomain-like
SuperFamilySSF542778.41E-18615705No hitNo description
SMARTSM006667.3E-13624706IPR000270PB1 domain
PROSITE profilePS5174519.598624706IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2405.1E-18624704No hitNo description
PfamPF005642.0E-14625704IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 714 aa     Download sequence    Send to blast
MEEIEKSQLP VNDDVVYEVY TSSEFKNYMG EPLSCSEERS NFHLMVFWSN NETESNFPHN  60
LIETSVKQKI KAALQRIETS QVILLQFWGL EKIEGRHFLT TSGQPFGLRY LYKGLCWYRK  120
HCQGYKYSVN NKGESSEQGT EKAHLFGPPA RVFQEKLPES STHVGYYTNE EFPMRDHAVR  180
CGVRTYLALP VFEPIGKNCV GVIELVTVWK GGYLTYEVEK VLNALEGVDL KCPKLYLQKA  240
RKVQAGKQSE RREIKRMLKI VRETHKLPFV RVWIPCKNLE MDHNGMYRGC TEHVISASNE  300
VYYVADEEMD ANDHVYDDYY YDDMLCFRDI SKLQPLQKDQ GVVGKAFFSG ELCYCENITE  360
FSIIEYPLVH YARWCGLTSS FAICLKNGDE AYILELFLPP DNGDPKILLG SILSTMGQHF  420
HNFKFASGQE LGHDSSVQVI KASSHKNVDY FHICQIRESP FMPEVLCDEE RSNRQMEGNE  480
SHREKEAISE CMVQNSVDNG QQQIMVQSDV LNTDIQVISE KQCVSITRLQ KESRTRTKDS  540
VNYDDLKQHF NKNLSDAAES LQVSRSTLKR LCRKYGIRRW PSSKRKKTVN ESNCQPLNML  600
PKKKKAITSA TTSTHANHVN SSSSITVKAT YGEDMMKFKL YSSSRKDDLD RELAKRLQLP  660
IGKFRIKYMD EDNDYIWIAC DDDLSDCFNN AQSLGKNTIK MLVLPAAINY SLEL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1584604RKKTVNESNCQPLNMLPKKKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009605048.10.0PREDICTED: protein NLP6-like isoform X1
TrEMBLM1AWJ60.0M1AWJ6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000319410.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13879911
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.18e-88Nin-like family protein